PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000784297
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 239aa    MW: 25873.5 Da    PI: 9.288
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000784297genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.5e-183479147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd  l ++v+++G+++W++I+r++  gR++k+c++rw + 
    MDP0000784297 34 KGPWSAEEDRVLTRLVERYGPRNWSLISRYIK-GRSGKSCRLRWCNQ 79
                     79*****************************9.***********985 PP

2Myb_DNA-binding49.97.1e-1688130347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++ Ede ++ a +++G++ W+tIar ++ gRt++ +k++w++ 
    MDP0000784297  88 SFSQAEDETILAAQARFGNR-WATIARLLP-GRTDNAVKNHWNST 130
                      699*****************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.0342984IPR017930Myb domain
SuperFamilySSF466893.52E-3031127IPR009057Homeodomain-like
SMARTSM007175.5E-163382IPR001005SANT/Myb domain
PfamPF002494.5E-173479IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-243587IPR009057Homeodomain-like
CDDcd001671.54E-143678No hitNo description
PROSITE profilePS5129419.58385135IPR017930Myb domain
SMARTSM007171.7E-1385133IPR001005SANT/Myb domain
CDDcd001673.16E-1088131No hitNo description
PfamPF002499.9E-1388130IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-2188134IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MEALXICSSS ASSSDTSSSE SSLTRNPNKP ERIKGPWSAE EDRVLTRLVE RYGPRNWSLI  60
SRYIKGRSGK SCRLRWCNQL SPSVQHRSFS QAEDETILAA QARFGNRWAT IARLLPGRTD  120
NAVKNHWNST LKRRVRGDQL TEGGSFLGGG GNVGSNEGMS TNSVSGSLVN GSMEFDPLTE  180
LTLAPPGIGS GSGGAMVAEQ RRNNESVPAG FWDAMRDVIA REVRDYVATT FSEPSGLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-443013554159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-443013554159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.165720.0cell culture| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008352004.11e-173PREDICTED: transcription factor MYB44-like
RefseqXP_008361013.11e-173PREDICTED: transcription factor MYB44-like
TrEMBLM5XHQ51e-125M5XHQ5_PRUPE; Uncharacterized protein
STRINGGLYMA06G04010.16e-92(Glycine max)
STRINGPOPTR_0002s13030.17e-92(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50743256
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.14e-58myb domain protein 73